General Information

  • ID:  hor000099
  • Uniprot ID:  P01180
  • Protein name:  Arg-vasopressin
  • Gene name:  AVP
  • Organism:  Bos taurus (Bovine)
  • Family:  Vasopressin/oxytocin family
  • Source:  animal
  • Expression:  hypothalamus
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005185 neurohypophyseal hormone activity; GO:0031894 V1A vasopressin receptor binding
  • GO BP:  GO:0007165 signal transduction; GO:0042310 vasoconstriction; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule

Sequence Information

  • Sequence:  CYFQNCPRG
  • Length:  9
  • Propeptide:  MPDATLPACFLSLLAFTSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGVGFPRRVRANDRSNATLLDGPSGALLLRLVQLAGAPEPAEPAQPGVY
  • Signal peptide:  MPDATLPACFLSLLAFTSA
  • Modification:  T9 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Has a direct antidiuretic action on the kidney, it also causes vasoconstriction of the peripheral vessels.
  • Mechanism:  Acts by binding to vasopressin receptors
  • Cross BBB:  YES
  • Target:  AVPR2, AVPR1A
  • Target Unid:  P48044, F6PV87
  • IC50: antidiuretic activity 408 IU/mg ( PubMed ID: 17258819 )
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 1.06±0.19 (fast phase) minutes; /63.6 seconds ( PubMed ID: 17258819 )

Structure

  • Disulfide bond:  1-6
  • Structure ID:  AF-P01180-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000099_AF2.pdbhor000099_ESM.pdb

Physical Information

Mass: 123011 Formula: C46H66N14O13S2
Absent amino acids: ADEHIKLMSTVW Common amino acids: C
pI: 8.22 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 1
Hydrophobicity: -77.78 Boman Index: -2076
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: 927.78 Extinction Coefficient cystines: 1615
Absorbance 280nm: 201.88

Literature

  • PubMed ID:  17258819
  • Title:  Enzymatic cleavage of glycinamide from vasopressin and a proposed structure for this pressor-antidiuretic hormone of the posterior pituitary.